General Information

  • ID:  hor005577
  • Uniprot ID:  P58990
  • Protein name:  Conophysin-R
  • Gene name:  NA
  • Organism:  Conus radiatus (Rayed cone)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  Expressed by the venom duct.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Phasmoconus (subgenus), Conus (genus), Conidae (family), Conoidea (superfamily), Neogastropoda (order), Caenogastropoda (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005185 neurohypophyseal hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HPTKPCMYCSFGQCVGPHICCGPTGCEMGTAEANMCSEEDEDPIPCQVFGSDCALNNPDNIHGHCVADGICCVDDTCTTHLGCL
  • Length:  84
  • Propeptide:  HPTKPCMYCSFGQCVGPHICCGPTGCEMGTAEANMCSEEDEDPIPCQVFGSDCALNNPDNIHGHCVADGICCVDDTCTTHLGCL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Targets vasopressin-oxytocin related receptors (By similarity). No effect observed when injected into goldfish or into mice.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-46; 9-20; 14-36; 21-26; 53-71; 65-83; 72-77
  • Structure ID:  AF-P04204-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P04204-F1.pdbhor005577_AF2.pdbhor005577_ESM.pdb

Physical Information

Mass: 1030566 Formula: C359H549N101O125S17
Absent amino acids: RW Common amino acids: C
pI: 4.02 Basic residues: 6
Polar residues: 37 Hydrophobic residues: 17
Hydrophobicity: -7.02 Boman Index: -9011
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 51.07
Instability Index: 2557.38 Extinction Coefficient cystines: 2365
Absorbance 280nm: 28.49

Literature

  • PubMed ID:  12076643
  • Title:  Conophysin-R, a Conus radiatus venom peptide belonging to the neurophysin family.